PDB entry 4w8l

View 4w8l on RCSB PDB site
Description: Structure of GH10 from Paenibacillus barcinonensis
Class: hydrolase
Keywords: glycoside hydrolase, hydrolase
Deposited on 2014-08-25, released 2015-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase C
    Species: Paenibacillus barcinonensis [TaxId:198119]
    Gene: XYNC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4w8la_
  • Chain 'B':
    Compound: Endo-1,4-beta-xylanase C
    Species: Paenibacillus barcinonensis [TaxId:198119]
    Gene: XYNC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4w8lb_
  • Chain 'C':
    Compound: Endo-1,4-beta-xylanase C
    Species: Paenibacillus barcinonensis [TaxId:198119]
    Gene: XYNC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4w8lc_
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4w8lA (A:)
    nipdlakklgssyalgaaidqtaldpkdphselltkhfnsitagnfmkmdamqptegkfv
    wseadklvnfaaannmqvrghtllwhsqvpdwfftdpndpskpatreqlmqrmkthiqti
    vsrykgkvhtwdvvnevisdggglrnqasgskwrdiigdvdgdgddsdyielafryarea
    dpdavlvindygiegsvskmndmvklvekllakgtpidaigfqmhvsmygpdikqireaf
    nraaalgvhiqvteldmsiysgnseqekpvtdemmleqayryralfdlfkefddrgvmds
    vtlwgladdgtwlddfpvkgrkdapllfdrklkakpaywalvdpstlpvyrn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4w8lB (B:)
    nipdlakklgssyalgaaidqtaldpkdphselltkhfnsitagnfmkmdamqptegkfv
    wseadklvnfaaannmqvrghtllwhsqvpdwfftdpndpskpatreqlmqrmkthiqti
    vsrykgkvhtwdvvnevisdggglrnqasgskwrdiigdvdgdgddsdyielafryarea
    dpdavlvindygiegsvskmndmvklvekllakgtpidaigfqmhvsmygpdikqireaf
    nraaalgvhiqvteldmsiysgnseqekpvtdemmleqayryralfdlfkefddrgvmds
    vtlwgladdgtwlddfpvkgrkdapllfdrklkakpaywalvdpstlpvyrn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4w8lC (C:)
    nipdlakklgssyalgaaidqtaldpkdphselltkhfnsitagnfmkmdamqptegkfv
    wseadklvnfaaannmqvrghtllwhsqvpdwfftdpndpskpatreqlmqrmkthiqti
    vsrykgkvhtwdvvnevisdggglrnqasgskwrdiigdvdgdgddsdyielafryarea
    dpdavlvindygiegsvskmndmvklvekllakgtpidaigfqmhvsmygpdikqireaf
    nraaalgvhiqvteldmsiysgnseqekpvtdemmleqayryralfdlfkefddrgvmds
    vtlwgladdgtwlddfpvkgrkdapllfdrklkakpaywalvdpstlpvyrn