PDB entry 4w86

View 4w86 on RCSB PDB site
Description: Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose and TRIS
Class: hydrolase
Keywords: glycoside hydrolase, cell wall degrading enzyme, GH5
Deposited on 2014-08-22, released 2015-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xyloglucan-specific endo-beta-1,4-glucanase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D2K7Z0 (0-338)
      • engineered mutation (74)
    Domains in SCOPe 2.06: d4w86a_
  • Chain 'B':
    Compound: Xyloglucan-specific endo-beta-1,4-glucanase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D2K7Z0 (0-338)
      • engineered mutation (74)
    Domains in SCOPe 2.06: d4w86b_
  • Heterogens: TRS, BGC, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4w86A (A:)
    drsrvfdilsninigwnlgntldatgggnsvnaetswgnpkttqeivdtvndrgfnairi
    pvtfanhlgpapeytisadwlarvkevvdyavndgmyiildthhetnywlktdpnneaal
    ceelaaiwkqlaeafkdydeklmfegmneprmagsakewsggtpaerklinamnkafida
    vratggnnadrvliictyghnsdeptlkdleipsdpniavalhtytpyfftyvadgsysv
    wngskknditwqynnikkylidkgipvvitetgaqfkentedivrwigdyvgtldqdgvk
    cfiwdnniyhgngekfgllnrsllkwynddivdayvnha
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4w86B (B:)
    drsrvfdilsninigwnlgntldatgggnsvnaetswgnpkttqeivdtvndrgfnairi
    pvtfanhlgpapeytisadwlarvkevvdyavndgmyiildthhetnywlktdpnneaal
    ceelaaiwkqlaeafkdydeklmfegmneprmagsakewsggtpaerklinamnkafida
    vratggnnadrvliictyghnsdeptlkdleipsdpniavalhtytpyfftyvadgsysv
    wngskknditwqynnikkylidkgipvvitetgaqfkentedivrwigdyvgtldqdgvk
    cfiwdnniyhgngekfgllnrsllkwynddivdayvnha