PDB entry 4w7w

View 4w7w on RCSB PDB site
Description: High-resolution structure of XacCel5A in complex with cellopentaose
Class: hydrolase
Keywords: (a/b)8-barrel glycosyl hydrolase family 5 cellulase, HYDROLASE
Deposited on 2014-08-22, released 2015-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: egl, XAC0030
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PRD3 (21-331)
      • expression tag (19-20)
    Domains in SCOPe 2.06: d4w7wa1, d4w7wa2
  • Heterogens: CBI, CTR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4w7wA (A:)
    mgsshhhhhhssglvprgshmlkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfag
    kgmntirlpflwervqpelngpldqaqlglikksleaakankqylildlhnyatysgkri
    gtsdvpagaladlwrrlalefkddkavifglmnepngisapdwanaaqgtitairktgak
    nlilvpgtaytgahswrstsygvsnakaleilkdpgnnlafeahqyldkdysgtkpvcts
    dsvgqeklqgftswlrenkqkgflgefatannpvcdkalegmltymeknsdvwlgwtwwa
    agawwkpdypftvqpgkdgsdkpqmailskya
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w7wA (A:)
    hmlkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfagkgmntirlpflwervqpel
    ngpldqaqlglikksleaakankqylildlhnyatysgkrigtsdvpagaladlwrrlal
    efkddkavifglmnepngisapdwanaaqgtitairktgaknlilvpgtaytgahswrst
    sygvsnakaleilkdpgnnlafeahqyldkdysgtkpvctsdsvgqeklqgftswlrenk
    qkgflgefatannpvcdkalegmltymeknsdvwlgwtwwaagawwkpdypftvqpgkdg
    sdkpqmailskya