PDB entry 4w6x

View 4w6x on RCSB PDB site
Description: Co-complex structure of the lectin domain of F18 fimbrial adhesin FedF with inhibitory nanobody NbFedF7
Class: cell adhesion
Keywords: Lectin, Fimbriae, cell adhesion, Inhibitor
Deposited on 2014-08-21, released 2014-12-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.188
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: f18 fimbrial adhesin ac
    Species: Escherichia coli [TaxId:562]
    Gene: fedF
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nanobody NbFedF7
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4W6X (0-End)
    Domains in SCOPe 2.05: d4w6xb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4w6xB (B:)
qvqlqesgggsvqaggslrlsctasgytyrkycmgwfrqapgkeregvacinsgggtsyy
adsvkgrftisqdnakdtvflrmnslkpedtaiyycalssnsvcppghvawyndwgqgtq
vtvsshhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4w6xB (B:)
qvqlqesgggsvqaggslrlsctasgytyrkycmgwfrqapgkeregvacinsgggtsyy
adsvkgrftisqdnakdtvflrmnslkpedtaiyycalssnsvcppghvawyndwgqgtq
vtvss