PDB entry 4w63

View 4w63 on RCSB PDB site
Description: torpedo californica acetylcholinesterase in complex with a tacrine-benzofuran hybrid inhibitor
Class: hydrolase
Keywords: multitarget drug, enzyme-inhibitor complex, tacrine, benzofuran, hydrolase
Deposited on 2014-08-20, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Torpedo californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4w63a_
  • Heterogens: NAG, HTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4w63A (A:)
    dhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnas
    typnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfy
    sgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvh
    dniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaeg
    rrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeff
    ptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvp
    handlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtyly
    ffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgn
    pnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat