PDB entry 4w4u

View 4w4u on RCSB PDB site
Description: Structure of yeast SAGA DUBm with Sgf73 Y57A mutant at 2.8 angstroms resolution
Class: transcription/hydrolase
Keywords: Multi-Protein Complex, Hydrolase-transcription complex, transcription-hydrolase complex
Deposited on 2014-08-15, released 2015-07-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:889517]
    Gene: CENPK1137D_262
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcription and mRNA export factor SUS1
    Species: SACCHAROMYCES CEREVISIAE [TaxId:889517]
    Gene: SUS1, CENPK1137D_4659
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4w4ub_
  • Chain 'C':
    Compound: SAGA-associated factor 11
    Species: SACCHAROMYCES CEREVISIAE [TaxId:889517]
    Gene: SGF11, CENPK1137D_1654
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ubiquitin carboxyl-terminal hydrolase
    Species: SACCHAROMYCES CEREVISIAE [TaxId:889517]
    Gene: CENPK1137D_262
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: SAGA-associated factor 73
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SGF73, YGL066W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53165
      • engineered mutation (56)
  • Chain 'F':
    Compound: Transcription and mRNA export factor SUS1
    Species: SACCHAROMYCES CEREVISIAE [TaxId:889517]
    Gene: SUS1, CENPK1137D_4659
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4w4uf_
  • Chain 'G':
    Compound: SAGA-associated factor 11
    Species: SACCHAROMYCES CEREVISIAE [TaxId:889517]
    Gene: SGF11, CENPK1137D_1654
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: SAGA-associated factor 73
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SGF73, YGL066W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53165 (Start-95)
      • engineered mutation (56)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4w4uB (B:)
    mtmdtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftq
    ilstvepkalemvsdstretvlkqirefleeivdtq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4w4uF (F:)
    mtmdtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftq
    ilstvepkalemvsdstretvlkqirefleeivdtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4w4uF (F:)
    mdtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqil
    stvepkalemvsdstretvlkqirefleeivdtq
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.