PDB entry 4vhb

View 4vhb on RCSB PDB site
Description: thiocyanate adduct of the bacterial hemoglobin from vitreoscilla sp.
Class: oxygen storage/transport
Keywords: hemoprotein, oxygen transport, oxygen storage/transport complex
Deposited on 1999-03-11, released 1999-08-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hemoglobin)
    Species: Vitreoscilla stercoraria [TaxId:61]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d4vhba_
  • Chain 'B':
    Compound: protein (hemoglobin)
    Species: Vitreoscilla stercoraria [TaxId:61]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d4vhbb_
  • Heterogens: SCN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4vhbA (A:)
    mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamt
    vlaaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddild
    awgkaygviadvfiqveadlyaqave
    

    Sequence, based on observed residues (ATOM records): (download)
    >4vhbA (A:)
    mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfeqpkalamtvlaaaqni
    enlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygv
    iadvfiqveadlyaqave
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4vhbB (B:)
    mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamt
    vlaaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddild
    awgkaygviadvfiqveadlyaqave
    

    Sequence, based on observed residues (ATOM records): (download)
    >4vhbB (B:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfleqpkalamtvlaaaqni
    enlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygv
    iadvfiqveadlyaqav