PDB entry 4vhb

View 4vhb on RCSB PDB site
Description: thiocyanate adduct of the bacterial hemoglobin from vitreoscilla sp.
Deposited on 1999-03-11, released 1999-08-31
The last revision prior to the SCOP 1.59 freeze date was dated 1999-08-31, with a file datestamp of 1999-08-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d4vhba_
  • Chain 'B':
    Domains in SCOP 1.59: d4vhbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4vhbA (A:)
    mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamt
    vlaaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddild
    awgkaygviadvfiqveadlyaqave
    

    Sequence, based on observed residues (ATOM records): (download)
    >4vhbA (A:)
    mldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfeqpkalamtvlaaaqni
    enlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygv
    iadvfiqveadlyaqave
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4vhbB (B:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
    laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
    wgkaygviadvfiqveadlyaqav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4vhbB (B:)
    ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfleqpkalamtvlaaaqni
    enlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygv
    iadvfiqveadlyaqav