PDB entry 4v3e

View 4v3e on RCSB PDB site
Description: The CIDRa domain from IT4var07 PfEMP1 bound to endothelial protein C receptor
Class: signaling protein
Keywords: signaling protein, pfemp1, epcr, malaria, cidr domain, endothelial protein c receptor, plasmodium falciparum
Deposited on 2014-10-17, released 2014-12-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: it4var07 cidra
    Species: PLASMODIUM FALCIPARUM [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • PDB 4V3E
  • Chain 'B':
    Compound: Endothelial protein C receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4v3eb_
  • Heterogens: PTY, NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4v3eB (B:)
lqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqs
glqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfr
peralwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhis

    Sequence, based on observed residues (ATOM records): (download) 
    >4v3eB (B:)
qrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqsg
lqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfrp
eralwqadtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhis