PDB entry 4v37

View 4v37 on RCSB PDB site
Description: Crystal structure of betaine aldehyde dehydrogenase from spinach showing a thiohemiacetal with 3-aminopropionaldehyde
Class: oxidoreductase
Keywords: oxidoreductase, betaine aldehyde dehydrogenase, aldh10
Deposited on 2014-10-16, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-20, with a file datestamp of 2016-01-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: betaine aldehyde dehydrogenase, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17202 (Start-496)
      • engineered mutation (290)
    Domains in SCOPe 2.07: d4v37a_
  • Chain 'B':
    Compound: betaine aldehyde dehydrogenase, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17202 (Start-496)
      • engineered mutation (290)
    Domains in SCOPe 2.07: d4v37b_
  • Chain 'C':
    Compound: betaine aldehyde dehydrogenase, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17202 (Start-496)
      • engineered mutation (290)
    Domains in SCOPe 2.07: d4v37c_
  • Chain 'D':
    Compound: betaine aldehyde dehydrogenase, chloroplastic
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17202
      • engineered mutation (290)
    Domains in SCOPe 2.07: d4v37d_
  • Heterogens: NAD, 0D8, FMT, PG4, K, AE3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4v37A (A:)
    mafpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrr
    nnwsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfag
    qaealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctav
    lkpselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatg
    skvmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqiasatsrllvh
    esiaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilygg
    srpehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaa
    avfsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnik
    qvtqdisdepwgwyksp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v37A (A:)
    fpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnn
    wsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqa
    ealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlk
    pselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgsk
    vmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqiasatsrllvhes
    iaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsr
    pehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaav
    fsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqv
    tqdisdepwgwyksp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4v37B (B:)
    mafpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrr
    nnwsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfag
    qaealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctav
    lkpselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatg
    skvmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqiasatsrllvh
    esiaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilygg
    srpehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaa
    avfsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnik
    qvtqdisdepwgwyksp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v37B (B:)
    piparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnnw
    satsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqae
    aldgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlkp
    selasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgskv
    masaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqiasatsrllvhesi
    aaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsrp
    ehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaavf
    sndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqvt
    qdisdepwgwyksp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4v37C (C:)
    mafpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrr
    nnwsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfag
    qaealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctav
    lkpselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatg
    skvmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqiasatsrllvh
    esiaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilygg
    srpehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaa
    avfsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnik
    qvtqdisdepwgwyksp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v37C (C:)
    fpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnn
    wsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqa
    ealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlk
    pselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgsk
    vmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqiasatsrllvhes
    iaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsr
    pehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaav
    fsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqv
    tqdisdepwgwyksp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4v37D (D:)
    mafpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrr
    nnwsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfag
    qaealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctav
    lkpselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatg
    skvmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqiasatsrllvh
    esiaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilygg
    srpehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaa
    avfsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnik
    qvtqdisdepwgwyksp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v37D (D:)
    piparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnnw
    satsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqae
    aldgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlkp
    selasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgskv
    masaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqiasatsrllvhesi
    aaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsrp
    ehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaavf
    sndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqvt
    qdisdepwgwyks