PDB entry 4v0n

View 4v0n on RCSB PDB site
Description: Crystal structure of BBS1N in complex with ARL6DN, soaked with mercury
Class: hydrolase/structural protein
Keywords: hydrolase-structural protein complex, bbsome, GTP, coat complex,
Deposited on 2014-09-17, released 2014-11-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 3.13 Å
R-factor: 0.2145
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: arf-like small gtpase
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A8JF99 (4-168)
    • expression tag (3)
  Domains in SCOPe 2.04: d4v0na_
• Chain 'B':
  Compound: bardet-biedl syndrome 1 protein
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A8JEA1 (Start-424)
    • conflict (36)
• Chain 'C':
  Compound: arf-like small gtpase
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A8JF99 (4-168)
    • expression tag (3)
  Domains in SCOPe 2.04: d4v0nc_
• Chain 'D':
  Compound: bardet-biedl syndrome 1 protein
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A8JEA1 (Start-424)
    • conflict (36)
• Chain 'E':
  Compound: arf-like small gtpase
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A8JF99 (4-168)
    • expression tag (3)
• Chain 'F':
  Compound: bardet-biedl syndrome 1 protein
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A8JEA1 (Start-424)
    • conflict (36)
• Chain 'G':
  Compound: arf-like small gtpase
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A8JF99 (4-168)
    • expression tag (3)
• Chain 'H':
  Compound: bardet-biedl syndrome 1 protein
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A8JEA1 (Start-424)
    • conflict (36)
• Heterogens: GTP, MG, HG

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4v0nA (A:)
  gaaskkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdms
  gagryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkd
  lpvamppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4v0nA (A:)
  skkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdmsgag
  ryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkdlpv
  amppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >4v0nC (C:)
  gaaskkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdms
  gagryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkd
  lpvamppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4v0nC (C:)
  skkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdmsgag
  ryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkdlpv
  amppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.