PDB entry 4v0n

View 4v0n on RCSB PDB site
Description: Crystal structure of BBS1N in complex with ARL6DN, soaked with mercury
Class: hydrolase/structural protein
Keywords: hydrolase-structural protein complex, bbsome, GTP, coat complex,
Deposited on 2014-09-17, released 2014-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 3.13 Å
R-factor: 0.2145
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arf-like small gtpase
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8JF99 (4-168)
      • expression tag (3)
    Domains in SCOPe 2.07: d4v0na1, d4v0na2
  • Chain 'B':
    Compound: bardet-biedl syndrome 1 protein
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8JEA1 (Start-424)
      • conflict (36)
  • Chain 'C':
    Compound: arf-like small gtpase
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8JF99 (4-168)
      • expression tag (3)
    Domains in SCOPe 2.07: d4v0nc1, d4v0nc2
  • Chain 'D':
    Compound: bardet-biedl syndrome 1 protein
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8JEA1 (Start-424)
      • conflict (36)
  • Chain 'E':
    Compound: arf-like small gtpase
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8JF99 (4-168)
      • expression tag (3)
    Domains in SCOPe 2.07: d4v0ne1, d4v0ne2
  • Chain 'F':
    Compound: bardet-biedl syndrome 1 protein
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8JEA1 (Start-424)
      • conflict (36)
  • Chain 'G':
    Compound: arf-like small gtpase
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8JF99 (4-168)
      • expression tag (3)
    Domains in SCOPe 2.07: d4v0ng1, d4v0ng2
  • Chain 'H':
    Compound: bardet-biedl syndrome 1 protein
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8JEA1 (Start-424)
      • conflict (36)
  • Heterogens: GTP, MG, HG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4v0nA (A:)
    gaaskkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdms
    gagryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkd
    lpvamppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v0nA (A:)
    skkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdmsgag
    ryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkdlpv
    amppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4v0nC (C:)
    gaaskkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdms
    gagryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkd
    lpvamppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v0nC (C:)
    skkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdmsgag
    ryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkdlpv
    amppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4v0nE (E:)
    gaaskkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdms
    gagryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkd
    lpvamppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v0nE (E:)
    skkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdmsgag
    ryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkdlpv
    amppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4v0nG (G:)
    gaaskkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdms
    gagryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkd
    lpvamppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v0nG (G:)
    skkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdmsgag
    ryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkdlpv
    amppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
    

  • Chain 'H':
    No sequence available.