PDB entry 4v0k

View 4v0k on RCSB PDB site
Description: Crystal structure of the CrARL6DN in the GDP bound form
Class: hydrolase
Keywords: hydrolase
Deposited on 2014-09-17, released 2014-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.1562
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arf-like small gtpase
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4v0ka_
  • Chain 'B':
    Compound: arf-like small gtpase
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4v0kb_
  • Heterogens: GDP, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4v0kA (A:)
    gaaskkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdms
    gagryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkd
    lpvamppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v0kA (A:)
    kvnvlvvgldnsgkttiierlkgftvdevekgpltftvfdmsgagryrtlweqyyreada
    vvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkdlpvamppveiaqalgldd
    ikdrpwqivpsngltgegvdkgidwlaerls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4v0kB (B:)
    gaaskkvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdms
    gagryrtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkd
    lpvamppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v0kB (B:)
    kvnvlvvgldnsgkttiierlkprprqaaevaptvgftvdevekgpltftvfdmsgagry
    rtlweqyyreadavvfvvdsadklrmvvardemehmlkhsnmrkvpilyfankkdlpvam
    ppveiaqalglddikdrpwqivpsngltgegvdkgidwlaerls