PDB entry 4v03

View 4v03 on RCSB PDB site
Description: MinD cell division protein, Aquifex aeolicus
Class: cell cycle
Keywords: cell cycle, bacterial cell division, ftsz, min system
Deposited on 2014-09-10, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2191
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: site-determining protein
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4v03a_
  • Chain 'B':
    Compound: site-determining protein
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4v03b_
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4v03A (A:)
    maevivitsgkggvgkttltanigtalaklgkkvllidadiglrnldmilglenrivydi
    ldvlegrvpyekalvkdkrglslwllpanqrankdvidiekwnktveeiknsgnydyilv
    dspagiekgfqiavspadkalivvnpevssirdadrvigllesmdkrnykvivnrikwem
    vkrgamlsvedivdilkaeiigiipeepklvdftnrgepivldekfpasqaiidtarrlm
    gesiplkrygshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v03A (A:)
    aevivitsgkggvgkttltanigtalaklgkkvllidadrnldmilglenrivydildvl
    egrvpyekalvkdkrglslwllpvidiekwnktveeiknsgnydyilvdspagiekgfqi
    avspadkalivvnpevssirdadrvigllesmdkrnykvivnrikwemvkrgamlsvedi
    vdilkaeiigiipeepklvdftnrgepivldekfpasqaiidtarrlmgesiplkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4v03B (B:)
    maevivitsgkggvgkttltanigtalaklgkkvllidadiglrnldmilglenrivydi
    ldvlegrvpyekalvkdkrglslwllpanqrankdvidiekwnktveeiknsgnydyilv
    dspagiekgfqiavspadkalivvnpevssirdadrvigllesmdkrnykvivnrikwem
    vkrgamlsvedivdilkaeiigiipeepklvdftnrgepivldekfpasqaiidtarrlm
    gesiplkrygshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v03B (B:)
    aevivitsgkggvgkttltanigtalaklgkkvllidadrnldmilglenrivydildvl
    egrvpyekalvkdkrglslwllpavidiekwnktveeiknsgnydyilvdspagiekgfq
    iavspadkalivvnpevssirdadrvigllesmdkrnykvivnrikwemvkrgamlsved
    ivdilkaeiigiipeepklvdftnrgepivldekfpasqaiidtarrlmgesiplk