PDB entry 4v02

View 4v02 on RCSB PDB site
Description: MinC:MinD cell division protein complex, Aquifex aeolicus
Class: cell cycle
Keywords: cell cycle, bacterial cell division, ftsz, min system
Deposited on 2014-09-10, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.1907
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: site-determining protein
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67033 (Start-249)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d4v02a_
  • Chain 'B':
    Compound: site-determining protein
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67033 (Start-249)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d4v02b_
  • Chain 'C':
    Compound: Probable septum site-determining protein MinC
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67034
      • expression tag (120-123)
  • Chain 'D':
    Compound: Probable septum site-determining protein MinC
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67034
      • expression tag (120-123)
  • Heterogens: MG, ATP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4v02A (A:)
    maevivitsgkggvgkttltanigtalaklgkkvllidaaiglrnldmilglenrivydi
    ldvlegrvpyekalvkdkrglslwllpanqrankdvidiekwnktveeiknsgnydyilv
    dspagiekgfqiavspadkalivvnpevssirdadrvigllesmdkrnykvivnrikwem
    vkrgamlsvedivdilkaeiigiipeepklvdftnrgepivldekfpasqaiidtarrlm
    gesiplkrygeshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v02A (A:)
    aevivitsgkggvgkttltanigtalaklgkkvllidaaiglrnldmilglenrivydil
    dvlegrvpyekalvkdkrglslwllpadvidiekwnktveeiknsgnydyilvdspagie
    kgfqiavspadkalivvnpevssirdadrvigllesmdkrnykvivnrikwemvkrgaml
    svedivdilkaeiigiipeepklvdftnrgepivldekfpasqaiidtarrlmgesiplk
    ryge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4v02B (B:)
    maevivitsgkggvgkttltanigtalaklgkkvllidaaiglrnldmilglenrivydi
    ldvlegrvpyekalvkdkrglslwllpanqrankdvidiekwnktveeiknsgnydyilv
    dspagiekgfqiavspadkalivvnpevssirdadrvigllesmdkrnykvivnrikwem
    vkrgamlsvedivdilkaeiigiipeepklvdftnrgepivldekfpasqaiidtarrlm
    gesiplkrygeshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v02B (B:)
    aevivitsgkggvgkttltanigtalaklgkkvllidaaiglrnldmilglenrivydil
    dvlegrvpyekalvkdkrglslwllpavidiekwnktveeiknsgnydyilvdspagiek
    gfqiavspadkalivvnpevssirdadrvigllesmdkrnykvivnrikwemvkrgamls
    vedivdilkaeiigiipeepklvdftnrgepivldekfpasqaiidtarrlmgesiplkr
    yg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.