PDB entry 4v01

View 4v01 on RCSB PDB site
Description: FGFR1 in complex with ponatinib (co-crystallisation).
Class: transferase
Keywords: transferase
Deposited on 2014-09-10, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, pfeiffer syndrome), isoform cra_b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4v01a_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, pfeiffer syndrome), isoform cra_b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4v01b_
  • Heterogens: SO4, EDO, 0LI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4v01A (A:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v01A (A:)
    lpedprwelprdrlvlgkplggqvvlaeaigldkpnrvtkvavkmlksdatekdlsdlis
    ememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppqlsskdlvsca
    yqvargmeylaskkcihrdlaarnvlvtednvmkiadfidyykkttngrlpvkwmapeal
    fdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelymm
    mrdcwhavpsqrptfkqlvedldrivaltsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4v01B (B:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4v01B (B:)
    seyelpedprwelprdrlvlgkplgeggqvvlaeaigldpnrvtkvavkmlksdatekdl
    sdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpqlsskdl
    vscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfidyykkttngrlpvkwma
    pealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctne
    lymmmrdcwhavpsqrptfkqlvedldrivaltsn