PDB entry 4uzu

View 4uzu on RCSB PDB site
Description: Three-dimensional structure of a variant `Termamyl-like' Geobacillus stearothermophilus alpha-amylase at 1.9 A resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 2014-09-09, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17196
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06279
      • conflict (72)
      • engineered mutation (190)
      • conflict (214)
      • conflict (247)
      • conflict (275)
      • conflict (278)
      • conflict (301)
      • conflict (413)
    Domains in SCOPe 2.07: d4uzua1, d4uzua2
  • Heterogens: GLY, CA, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uzuA (A:)
    aapfngtmmqyfewylpddgtlwtkvaneannlsslgitalwlppaykgtsrsdvgygvy
    dlydlgefnqkgtvrtkygtkaqylqaiqaahaagmqvyadvvfdhkggadgtewvdave
    vnpsdrnqeisgtyqiqawtkfdfpgrgntyssfkwrwyhfdgvdwdesrklsriykfrg
    kawdwevdtefgnydylmyadldmdhpevvtelknwgkwyvnttnidgfrldavkhikfs
    ffpdwlsyvrsqtgkplftvgeywsydinklhnyitktdgtmslfdaplhnkfytasksg
    gafdmrtlmtntlmkdqptlavtfvdnhdtepgqalqswvdpwfkplayafiltrqegyp
    cvfygdyygipqynipslkskidplliarrdyaygtqhdyldhsdiigwtreggtekpgs
    glaalitdgpggskwmyvgkqhagkvfydltgnrsdtvtinsdgwgefkvnggsvsvwvp
    rkttvstiarpittrpwtgefvrwteprlvawp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uzuA (A:)
    fngtmmqyfewylpddgtlwtkvaneannlsslgitalwlppaykgtsrsdvgygvydly
    dlgefnqkgtvrtkygtkaqylqaiqaahaagmqvyadvvfdhkggadgtewvdavevnp
    sdrnqeisgtyqiqawtkfdfpgrgntyssfkwrwyhfdgvdwdesrklsriykfrgkaw
    dwevdtefgnydylmyadldmdhpevvtelknwgkwyvnttnidgfrldavkhikfsffp
    dwlsyvrsqtgkplftvgeywsydinklhnyitktdgtmslfdaplhnkfytasksggaf
    dmrtlmtntlmkdqptlavtfvdnhdtepgqalqswvdpwfkplayafiltrqegypcvf
    ygdyygipqynipslkskidplliarrdyaygtqhdyldhsdiigwtreggtekpgsgla
    alitdgpggskwmyvgkqhagkvfydltgnrsdtvtinsdgwgefkvnggsvsvwvprk