PDB entry 4uxj

View 4uxj on RCSB PDB site
Description: Leishmania major Thymidine Kinase in complex with dTTP
Class: transferase
Keywords: transferase
Deposited on 2014-08-22, released 2015-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uxja1, d4uxja2
  • Chain 'B':
    Compound: Thymidine kinase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uxjb1, d4uxjb2
  • Chain 'C':
    Compound: Thymidine kinase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uxjc1, d4uxjc2
  • Chain 'D':
    Compound: Thymidine kinase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uxjd1, d4uxjd2
  • Chain 'E':
    Compound: Thymidine kinase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uxje1, d4uxje2
  • Chain 'F':
    Compound: Thymidine kinase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uxjf1, d4uxjf2
  • Chain 'G':
    Compound: Thymidine kinase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uxjg1, d4uxjg2
  • Chain 'H':
    Compound: Thymidine kinase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uxjh1, d4uxjh2
  • Heterogens: ZN, TTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uxjA (A:)
    msghhhhhhfrgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnva
    shdqlmlraqaavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsald
    gdyrrkpfgqicelvpyceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiat
    crecyskqqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxjA (A:)
    rgrieliigpmfagkttelmrrvkreiharrscfvikysdqlmlraqaavsqltevrdtw
    krfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvpyceavdk
    ltavcmmcheqpacftrrtvnveqqeliggadmyiatcrecyskqql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uxjB (B:)
    msghhhhhhfrgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnva
    shdqlmlraqaavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsald
    gdyrrkpfgqicelvpyceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiat
    crecyskqqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxjB (B:)
    rgrieliigpmfagkttelmrrvkreiharrscfvikysshdqlmlraqaavsqltevrd
    twkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvpyceav
    dkltavcmmcheqpacftrrtvnveqqeliggadmyiatcrecysk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4uxjC (C:)
    msghhhhhhfrgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnva
    shdqlmlraqaavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsald
    gdyrrkpfgqicelvpyceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiat
    crecyskqqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxjC (C:)
    rgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvalraqaavsql
    tevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvp
    yceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiatcrecysk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4uxjD (D:)
    msghhhhhhfrgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnva
    shdqlmlraqaavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsald
    gdyrrkpfgqicelvpyceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiat
    crecyskqqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxjD (D:)
    rgrieliigpmfagkttelmrrvkreiharrscfvikylraqaavsqltevrdtwkrfdv
    laidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvpyceavdkltavc
    mmcheqpacftrrtvnveqqeliggadmyiatcrecysk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4uxjE (E:)
    msghhhhhhfrgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnva
    shdqlmlraqaavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsald
    gdyrrkpfgqicelvpyceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiat
    crecyskqqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxjE (E:)
    rgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvasaqaavsqlt
    evrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvpy
    ceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiatcrecysk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4uxjF (F:)
    msghhhhhhfrgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnva
    shdqlmlraqaavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsald
    gdyrrkpfgqicelvpyceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiat
    crecyskqqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxjF (F:)
    rgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydhdqlmlraqaavsql
    tevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvp
    yceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiatcrecyskqq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4uxjG (G:)
    msghhhhhhfrgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnva
    shdqlmlraqaavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsald
    gdyrrkpfgqicelvpyceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiat
    crecyskqqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxjG (G:)
    rgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnlraqaavsqlte
    vrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvpyc
    eavdkltavcmmcheqpacftrrtvnveqqeliggadmyiatcrecysk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4uxjH (H:)
    msghhhhhhfrgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnva
    shdqlmlraqaavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsald
    gdyrrkpfgqicelvpyceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiat
    crecyskqqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxjH (H:)
    rgrieliigpmfagkttelmrrvkreiharrscfvikylraqaavsqltevrdtwkrfdv
    laidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvpyceavdkltavc
    mmcheqpacftrrtvnveqqeliggadmyiatcrecy