PDB entry 4uxi

View 4uxi on RCSB PDB site
Description: Leishmania major Thymidine Kinase in complex with thymidine
Class: transferase
Keywords: transferase, ap5dt
Deposited on 2014-08-22, released 2015-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uxia1, d4uxia2
  • Chain 'B':
    Compound: Thymidine kinase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uxib1, d4uxib2
  • Heterogens: PO4, THM, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uxiA (A:)
    gpfrgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvashdqlml
    raqaavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkp
    fgqicelvpyceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiatcrecysk
    qqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxiA (A:)
    frgrieliigpmfagkttelmrrvkreiharrscfvikysmlraqaavsqltevrdtwkr
    fdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvpyceavdklt
    avcmmcheqpacftrrtvnveqqeliggadmyiatcrecyskqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uxiB (B:)
    gpfrgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvashdqlml
    raqaavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkp
    fgqicelvpyceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiatcrecysk
    qqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxiB (B:)
    rgrieliigpmfagkttelmrrvkreiharrscfvikysraqaavsqltevrdtwkrfdv
    laidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvpyceavdkltavc
    mmcheqpacftrrtvnveqqeliggadmyiatcrecyskq