PDB entry 4uxh

View 4uxh on RCSB PDB site
Description: Leishmania major Thymidine Kinase in complex with AP5dT
Class: transferase
Keywords: transferase
Deposited on 2014-08-22, released 2015-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uxha1, d4uxha2
  • Chain 'B':
    Compound: Thymidine kinase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uxhb1, d4uxhb2
  • Heterogens: T5A, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uxhA (A:)
    gpfrgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvashdqlml
    raqaavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkp
    fgqicelvpyceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiatcrecysk
    qqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxhA (A:)
    rgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvalmlraqaavs
    qltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicel
    vpyceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiatcrecysk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uxhB (B:)
    gpfrgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvashdqlml
    raqaavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkp
    fgqicelvpyceavdkltavcmmcheqpacftrrtvnveqqeliggadmyiatcrecysk
    qqlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uxhB (B:)
    rgrieliigpmfagkttelmrrvkreiharrscfvikyskdlraqaavsqltevrdtwkr
    fdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvpyceavdklt
    avcmmcheqpacftrrtvnveqqeliggadmyiatcrecyskqq