PDB entry 4uwy

View 4uwy on RCSB PDB site
Description: FGFR1 Apo structure
Class: transferase
Keywords: transferase, inhibitor, drug, cancer, fgf, receptors, growth factors, signalling
Deposited on 2014-08-15, released 2015-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • conflict (128)
    Domains in SCOPe 2.07: d4uwya_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uwyb_
  • Heterogens: PEG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uwyA (A:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uwyA (A:)
    eyelpedprwelprdrlvlgkplgqvvlaeaigldkdkpnrvtkvavkmlksdatekdls
    dlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgleysyn
    pshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglar
    dihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpv
    eelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uwyB (B:)
    mvagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkm
    lksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqa
    rrppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtedn
    vmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweift
    lggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedld
    rivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uwyB (B:)
    gvseyelpedprwelprdrlvlgkplgegqvvlaeaigldkdkpnrvtkvavkmlksdat
    ekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpeql
    sskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardlpvkwmap
    ealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnel
    ymmmrdcwhavpsqrptfkqlvedldrivalts