PDB entry 4uwc

View 4uwc on RCSB PDB site
Description: Fibroblast growth factor receptor 1 kinase in complex with JK-P3
Class: transferase
Keywords: transferase, receptor tyrosine kinase, transferase inhibitor
Deposited on 2014-08-11, released 2015-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (Start-308)
      • engineered mutation (31)
      • engineered mutation (127)
    Domains in SCOPe 2.07: d4uwca_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (31)
      • engineered mutation (127)
    Domains in SCOPe 2.07: d4uwcb_
  • Heterogens: EDO, 4Y0, PPI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uwcA (A:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uwcA (A:)
    lpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatekd
    lsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgleys
    ynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgl
    ardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgv
    pveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnq
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uwcB (B:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uwcB (B:)
    gvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkpnrvtkvavkmlksda
    tekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppg
    leysyhnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
    lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
    vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
    q