PDB entry 4uwb

View 4uwb on RCSB PDB site
Description: Fibroblast growth factor receptor 1 kinase in complex with JK-P5
Class: transferase
Keywords: transferase
Deposited on 2014-08-11, released 2015-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (Start-308)
      • engineered mutation (31)
      • engineered mutation (127)
    Domains in SCOPe 2.07: d4uwba_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (Start-308)
      • engineered mutation (31)
      • engineered mutation (127)
    Domains in SCOPe 2.07: d4uwbb_
  • Heterogens: EDO, JVT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uwbA (A:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uwbA (A:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
    dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
    spshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgla
    rdhhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpv
    eelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uwbB (B:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uwbB (B:)
    gvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkpnrvtkvavkmlksda
    tekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppg
    leysyhnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
    larhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpv
    eelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe