PDB entry 4uuq

View 4uuq on RCSB PDB site
Description: Crystal structure of human mono-glyceride lipase in complex with SAR127303
Class: hydrolase
Keywords: hydrolase
Deposited on 2014-07-30, released 2015-01-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.215
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monoglyceride lipase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uuqa_
  • Chain 'B':
    Compound: Monoglyceride lipase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uuqb_
  • Heterogens: 64D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uuqA (A:)
    mhhhhhhmetgpedpssmpeessprrtpqsipyqdlphlvnadgqylfcrywkptgtpka
    lifvshgagehsgryeelarmlmgldllvfahdhvghgqsegermvvsdfhvfvrdvlqh
    vdsmqkdypglpvfllghsmggaiailtaaerpghfagmvlisplvlanpesattfkvla
    akvlnlvlpnlslgpidssvlsrnktevdiynsdplicraglkvcfgiqllnavsrvera
    lpkltvpflllqgsadrlcdskgayllmelaksqdktlkiyegayhvlhkelpevtnsvf
    heinmwvsqrtatagtaspp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uuqA (A:)
    sprrtpqsipyqdlphlvnadgqylfcrywkptgtpkalifvshgagehsgryeelarml
    mgldllvfahdhvghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmgg
    aiailtaaerpghfagmvlisplvlanpesattfkvlaakvlnlvlpnlslgpidssvls
    rnktevdiynsdplicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdsk
    gayllmelaksqdktlkiyegayhvlhkelpevtnsvfheinmwvsqrta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uuqB (B:)
    mhhhhhhmetgpedpssmpeessprrtpqsipyqdlphlvnadgqylfcrywkptgtpka
    lifvshgagehsgryeelarmlmgldllvfahdhvghgqsegermvvsdfhvfvrdvlqh
    vdsmqkdypglpvfllghsmggaiailtaaerpghfagmvlisplvlanpesattfkvla
    akvlnlvlpnlslgpidssvlsrnktevdiynsdplicraglkvcfgiqllnavsrvera
    lpkltvpflllqgsadrlcdskgayllmelaksqdktlkiyegayhvlhkelpevtnsvf
    heinmwvsqrtatagtaspp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uuqB (B:)
    dlphlvnadgqylfcrywkptgtpkalifvshgagehsgryeelarmlmgldllvfahdh
    vghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmggaiailtaaerpg
    hfagmvlisplvlanpesattfkvlaakvlnlvlpnlslgpidssvlsrnktevdiynsd
    plicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdskgayllmelaksq
    dktlkiyegayhvlhkelpevtnsvfheinmwvsqrta