PDB entry 4uul

View 4uul on RCSB PDB site
Description: Apo trichomonas vaginalis lactate dehydrogenase L91R
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2014-07-29, released 2015-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Trichomonas vaginalis [TaxId:5722]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96445 (Start-332)
      • expression tag (333-334)
      • engineered mutation (90)
    Domains in SCOPe 2.07: d4uula1, d4uula2, d4uula3
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Trichomonas vaginalis [TaxId:5722]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96445 (Start-332)
      • expression tag (333-337)
      • engineered mutation (90)
    Domains in SCOPe 2.07: d4uulb1, d4uulb2, d4uulb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uulA (A:)
    mseaahvlitgaagqigyilshwiasgelygdrqvylhlldippamnrltaltmeledca
    fphlagfvattdpkaafkdidcaflvasmprkpgqvradlissnsvifkntgeylskwak
    psvkvlvignpdntnceiamlhaknlkpenfsslsmldqnrayyevasklgvdvkdvhdi
    ivwgnhgesmvadltqatftkegktqkvvdvldhdyvfdtffkkighrawdilehrgfts
    aasptkaaiqhmkawlfgtapgevlsmgipvpegnpygikpgvvfsfpcnvdkegkihvv
    egfkvndwlrekldftekdlfhekeialnhlaqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uulA (A:)
    seaahvlitgaagqigyilshwiasgelygdrqvylhlldippamnrltaltmeledcaf
    phlagfvattdpkaafkdidcaflvasmprkpgqvradlissnsvifkntgeylskwakp
    svkvlvignpdntnceiamlhaknlkpenfsslsmldqnrayyevasklgvdvkdvhdii
    vwgnhgesmvadltqatftkegktqkvvdvldhdyvfdtffkkighrawdilehrgftsa
    asptkaaiqhmkawlfgtapgevlsmgipvpegnpygikpgvvfsfpcnvdkegkihvve
    gfkvndwlrekldftekdlfhekeialnhlaqle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uulB (B:)
    mseaahvlitgaagqigyilshwiasgelygdrqvylhlldippamnrltaltmeledca
    fphlagfvattdpkaafkdidcaflvasmprkpgqvradlissnsvifkntgeylskwak
    psvkvlvignpdntnceiamlhaknlkpenfsslsmldqnrayyevasklgvdvkdvhdi
    ivwgnhgesmvadltqatftkegktqkvvdvldhdyvfdtffkkighrawdilehrgfts
    aasptkaaiqhmkawlfgtapgevlsmgipvpegnpygikpgvvfsfpcnvdkegkihvv
    egfkvndwlrekldftekdlfhekeialnhlaqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uulB (B:)
    seaahvlitgaagqigyilshwiasgelygdrqvylhlldippamnrltaltmeledcaf
    phlagfvattdpkaafkdidcaflvasmprkpgqvradlissnsvifkntgeylskwakp
    svkvlvignpdntnceiamlhaknlkpenfsslsmldqnrayyevasklgvdvkdvhdii
    vwgnhgesmvadltqatftkegktqkvvdvldhdyvfdtffkkighrawdilehrgftsa
    asptkaaiqhmkawlfgtapgevlsmgipvpegnpygikpgvvfsfpcnvdkegkihvve
    gfkvndwlrekldftekdlfhekeialnhlaqlehhh