PDB entry 4utc

View 4utc on RCSB PDB site
Description: Crystal structure of dengue 2 virus envelope glycoprotein
Class: viral protein
Keywords: viral protein, membrane fusion, class 2 fusion protein,
Deposited on 2014-07-18, released 2015-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 3.08 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope glycoprotein E
    Species: DENGUE VIRUS 2 [TaxId:11060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q68Y26 (0-390)
      • expression tag (391-394)
      • conflict (117)
    Domains in SCOPe 2.07: d4utca1, d4utca2, d4utca3
  • Chain 'B':
    Compound: envelope glycoprotein E
    Species: DENGUE VIRUS 2 [TaxId:11060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q68Y26 (0-390)
      • expression tag (391-394)
      • conflict (117)
    Domains in SCOPe 2.07: d4utcb1, d4utcb2, d4utcb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4utcA (A:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakft
    ckknmegkivqpenleytivitphsgeehavgndtgkhgkeikitpqsstteaeltgygt
    vtmecsprtgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkivkeiaetqhgtivirvqyegdgspckipfeitdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiivgvepgqlklnwlrplesrgpfegkpipnpllgldstrtgh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4utcA (A:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakft
    ckknmegkivqpenleytivitphsgeehavgndtgkhgkeikitpqsstteaeltgygt
    vtmecsprtdfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtfkn
    phakkqdvvvlgsqegamhtaltgateiqmssgnllfhlkcrlrmdklqlkgmsysmctg
    kfkivkeiaetqhgtivirvqyegdgspckipfeitdlekrhvlgrlitvnpivtekdsp
    vnieaeppfgdsyiivgvepgqlklnwlrpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4utcB (B:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakft
    ckknmegkivqpenleytivitphsgeehavgndtgkhgkeikitpqsstteaeltgygt
    vtmecsprtgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkivkeiaetqhgtivirvqyegdgspckipfeitdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiivgvepgqlklnwlrplesrgpfegkpipnpllgldstrtgh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4utcB (B:)
    mrcigisnrdfvegwvdivlehgscvttmaknkptldfelikteakqpatlrkycieakl
    tntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakftckknm
    egkivqpenleytivitphsgeehavgndtgkhgkeikitpqsstteaeltgygtvtmec
    sprtgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtfknpha
    kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmctgk
    fkivkeiaetqhgtivirvqyegdgspckipfeitdlekrhvlgrlitvnpivtekdspv
    nieaeppfgdsyiivgvepgqlklnwlrpl