PDB entry 4uta

View 4uta on RCSB PDB site
Description: Crystal structure of dengue 2 virus envelope glycoprotein in complex with the Fab fragment of the broadly neutralizing human antibody EDE1 C8
Class: immune system-viral protein complex
Keywords: immune system-viral protein complex, viral protein, membrane fusion, class 2 fusion protein, dengue virus, broadly neutralizing antibody
Deposited on 2014-07-18, released 2015-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope glycoprotein E
    Species: DENGUE VIRUS 2 [TaxId:11060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q68Y26 (0-390)
      • expression tag (391-394)
      • conflict (117)
    Domains in SCOPe 2.07: d4utaa1, d4utaa2, d4utaa3
  • Chain 'B':
    Compound: envelope glycoprotein E
    Species: DENGUE VIRUS 2 [TaxId:11060]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q68Y26 (0-390)
      • expression tag (391-397)
      • conflict (117)
    Domains in SCOPe 2.07: d4utab1, d4utab2, d4utab3
  • Chain 'H':
    Compound: broadly neutralizing human antibody ede1 c8 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UTA
  • Chain 'I':
    Compound: broadly neutralizing human antibody ede1 c8 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UTA
  • Chain 'L':
    Compound: broadly neutralizing human antibody ede1 c8 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UTA
    Domains in SCOPe 2.07: d4utal1, d4utal2
  • Chain 'M':
    Compound: broadly neutralizing human antibody ede1 c8 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UTA
    Domains in SCOPe 2.07: d4utam1, d4utam2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4utaA (A:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakft
    ckknmegkivqpenleytivitphsgeehavgndtgkhgkeikitpqsstteaeltgygt
    vtmecsprtgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkivkeiaetqhgtivirvqyegdgspckipfeitdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiivgvepgqlklnwlrplesrgpfegkpipnpllgldstrtgh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4utaA (A:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakft
    ckknmegkivqpenleytivitphsgeehkhgkeikitpqsstteaeltgygtvtmecsp
    rtgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtfknphakk
    qdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmctgkfk
    ivkeiaetqhgtivirvqgspckipfeitdvlgrlitvnpivtekdspvnieaeppfgds
    yiivlklnwlrpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4utaB (B:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakft
    ckknmegkivqpenleytivitphsgeehavgndtgkhgkeikitpqsstteaeltgygt
    vtmecsprtgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkivkeiaetqhgtivirvqyegdgspckipfeitdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiivgvepgqlklnwlrplesrgpfegkpipnpllgldstrtgh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4utaB (B:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakft
    ckknmegkivqpenleytivitphsgeehhgkeikitpqsstteaeltgygtvtmecspr
    tgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtfknphakkq
    dvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmctgkfki
    vkeiaetqhgtivirvqyegdgspckipfeikrhvlgrlitvnpivtekdspvnieaepp
    fgdsyiivgvepgqlklnwlrplesr
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4utaL (L:)
    rseivltqspatlslspgeratlscrasqsistflawyqhkpgqaprlliydastratgv
    parfsgsrsgtdftltistlepedfavyycqqrynwppytfgqgtkveikrtvaapsvfi
    fppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslss
    tltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4utaL (L:)
    seivltqspatlslspgeratlscrasqsistflawyqhkpgqaprlliydastratgvp
    arfsgsrsgtdftltistlepedfavyycqqrynwppytfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4utaM (M:)
    rseivltqspatlslspgeratlscrasqsistflawyqhkpgqaprlliydastratgv
    parfsgsrsgtdftltistlepedfavyycqqrynwppytfgqgtkveikrtvaapsvfi
    fppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslss
    tltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4utaM (M:)
    seivltqspatlslspgeratlscrasqsistflawyqhkpgqaprlliydastratgvp
    arfsgsrsgtdftltistlepedfavyycqqrynwppytfgqgtkveikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge