PDB entry 4uro

View 4uro on RCSB PDB site
Description: Crystal Structure of Staph GyraseB 24kDa in complex with Novobiocin
Class: isomerase
Keywords: isomerase, antibiotics, topoisomerase IV, natural product
Deposited on 2014-07-01, released 2014-07-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.1978
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K8 (Start-230)
      • conflict (27)
    Domains in SCOPe 2.06: d4uroa_
  • Chain 'B':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K8 (Start-230)
      • conflict (27)
    Domains in SCOPe 2.06: d4urob_
  • Chain 'C':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K8
      • conflict (27)
    Domains in SCOPe 2.06: d4uroc_
  • Chain 'D':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K8
      • conflict (27)
    Domains in SCOPe 2.06: d4urod_
  • Heterogens: NOV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uroA (A:)
    mvtalsdvnntdnygagqiqvlegleaarkrpgmyigstserglhhlvweivdnsideal
    agyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltvlhaggkfggggykvs
    gglhgvgssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevgttdktgtvirfkad
    geiftettvynyetlqqrirelaflnkgiqitlrderdeenvredsyhyeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uroA (A:)
    eaarkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdngrg
    ipvdiqekmgrpaveviltvgvgssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlke
    vgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvre
    dsyhyeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uroB (B:)
    mvtalsdvnntdnygagqiqvlegleaarkrpgmyigstserglhhlvweivdnsideal
    agyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltvlhaggkfggggykvs
    gglhgvgssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevgttdktgtvirfkad
    geiftettvynyetlqqrirelaflnkgiqitlrderdeenvredsyhyeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uroB (B:)
    eaarkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdngrg
    ipvdiqekmgrpaveviltvvgssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkev
    gttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvred
    syhyeg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4uroC (C:)
    mvtalsdvnntdnygagqiqvlegleaarkrpgmyigstserglhhlvweivdnsideal
    agyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltvlhaggkfggggykvs
    gglhgvgssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevgttdktgtvirfkad
    geiftettvynyetlqqrirelaflnkgiqitlrderdeenvredsyhyeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uroC (C:)
    leaarkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdngr
    gipvdiqekmgrpaveviltvgssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkev
    gttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvred
    syhye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4uroD (D:)
    mvtalsdvnntdnygagqiqvlegleaarkrpgmyigstserglhhlvweivdnsideal
    agyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltvlhaggkfggggykvs
    gglhgvgssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevgttdktgtvirfkad
    geiftettvynyetlqqrirelaflnkgiqitlrderdeenvredsyhyeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uroD (D:)
    leaarkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdngr
    gipvdipaveviltvvgssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevgttdk
    tgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvredsyhye