PDB entry 4urn

View 4urn on RCSB PDB site
Description: Crystal Structure of Staph ParE 24kDa in complex with Novobiocin
Class: isomerase
Keywords: isomerase, antibiotics, gyrase, natural product
Deposited on 2014-07-01, released 2014-07-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2248
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase IV, B subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4urna_
  • Chain 'B':
    Compound: DNA topoisomerase IV, B subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4urnb_
  • Chain 'C':
    Compound: DNA topoisomerase IV, B subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4urnc_
  • Heterogens: NOV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4urnA (A:)
    mamnkqnnysddsiqvlegleavrkrpgmyigstdkrglhhlvyeivdnsvdevlngygn
    eidvtinkdgsisiedngrgmptgihksgkptveviftvlhaggkfgqggyktsgglhgv
    gasvvnalsewleveihrdgniyhqsfknggspssglvkkgktkktgtkvtfkpddtifk
    astsfnfdvlserlqesafllknlkitlndlrsgkerqehyhyee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4urnA (A:)
    legleavrkrpgmyigstdkrglhhlvyeivdnsvdevlngygneidvtinkdgsisied
    ngrgmptgihksgkptveviftvlvgasvvnalsewleveihrdgniyhqsfknggspss
    glvkkgktkktgtkvtfkpddtifkastsfnfdvlserlqesafllknlkitlndlrsgk
    erqehyhy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4urnB (B:)
    mamnkqnnysddsiqvlegleavrkrpgmyigstdkrglhhlvyeivdnsvdevlngygn
    eidvtinkdgsisiedngrgmptgihksgkptveviftvlhaggkfgqggyktsgglhgv
    gasvvnalsewleveihrdgniyhqsfknggspssglvkkgktkktgtkvtfkpddtifk
    astsfnfdvlserlqesafllknlkitlndlrsgkerqehyhyee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4urnB (B:)
    gstdkrglhhlvyeivdnsvdevlngygneidvtinkdgsisiedngrgmptgihksgkp
    tveviftvlgvgasvvnalsewleveihrdgniyhqsfknggspssglvkkgktkktgtk
    vtfkpddtifkastsfnfdvlserlqesafllknlkitlndlrsgkerqehyhy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4urnC (C:)
    mamnkqnnysddsiqvlegleavrkrpgmyigstdkrglhhlvyeivdnsvdevlngygn
    eidvtinkdgsisiedngrgmptgihksgkptveviftvlhaggkfgqggyktsgglhgv
    gasvvnalsewleveihrdgniyhqsfknggspssglvkkgktkktgtkvtfkpddtifk
    astsfnfdvlserlqesafllknlkitlndlrsgkerqehyhyee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4urnC (C:)
    gleavrkrpgmyigstdkrglhhlvyeivdnsvdevlngygneidvtinkdgsisiedng
    rgmptgihksgkptveviftvlgasvvnalsewleveihrdgniyhqsfknggspssglv
    kkgktkktgtkvtfkpddtifkastsfnfdvlserlqesafllknlkitlndlrsgkerq
    ehyhye