PDB entry 4urm

View 4urm on RCSB PDB site
Description: Crystal Structure of Staph GyraseB 24kDa in complex with Kibdelomycin
Class: isomerase
Keywords: isomerase, antibiotics, gyrase, topoisomerase IV, natural product
Deposited on 2014-06-30, released 2014-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: 0.1984
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K8 (Start-230)
      • conflict (27)
    Domains in SCOPe 2.07: d4urma_
  • Chain 'B':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K8 (Start-230)
      • conflict (27)
    Domains in SCOPe 2.07: d4urmb_
  • Chain 'C':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K8 (Start-230)
      • conflict (27)
    Domains in SCOPe 2.07: d4urmc_
  • Chain 'D':
    Compound: DNA gyrase subunit b
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K8 (Start-230)
      • conflict (27)
    Domains in SCOPe 2.07: d4urmd_
  • Heterogens: XAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4urmA (A:)
    mvtalsdvnntdnygagqiqvlegleaarkrpgmyigstserglhhlvweivdnsideal
    agyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltvlhaggkfggggykvs
    gglhgvgssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevgttdktgtvirfkad
    geiftettvynyetlqqrirelaflnkgiqitlrderdeenvredsyhyeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4urmA (A:)
    leaarkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdngr
    gipvdiqekmgrpaveviltvlhaggkgvgssvvnalsqdlevyvhrnetiyhqaykkgv
    pqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrder
    deenvredsyhyeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4urmB (B:)
    mvtalsdvnntdnygagqiqvlegleaarkrpgmyigstserglhhlvweivdnsideal
    agyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltvlhaggkfggggykvs
    gglhgvgssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevgttdktgtvirfkad
    geiftettvynyetlqqrirelaflnkgiqitlrderdeenvredsyhyeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4urmB (B:)
    leaarkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdngr
    gipvdiqekmgrpaveviltvlhaggkfgvgssvvnalsqdlevyvhrnetiyhqaykkg
    vpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrde
    rdeenvredsyhyeg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4urmC (C:)
    mvtalsdvnntdnygagqiqvlegleaarkrpgmyigstserglhhlvweivdnsideal
    agyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltvlhaggkfggggykvs
    gglhgvgssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevgttdktgtvirfkad
    geiftettvynyetlqqrirelaflnkgiqitlrderdeenvredsyhyeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4urmC (C:)
    leaarkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdngr
    gipvdiqekmgrpaveviltvlhagvgssvvnalsqdlevyvhrnetiyhqaykkgvpqf
    dlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdee
    nvredsyhyeg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4urmD (D:)
    mvtalsdvnntdnygagqiqvlegleaarkrpgmyigstserglhhlvweivdnsideal
    agyanqievviekdnwikvtdngrgipvdiqekmgrpaveviltvlhaggkfggggykvs
    gglhgvgssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevgttdktgtvirfkad
    geiftettvynyetlqqrirelaflnkgiqitlrderdeenvredsyhyeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4urmD (D:)
    eaarkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdngrg
    ipvdiqekmgrpaveviltvlhagvgssvvnalsqdlevyvhrnetiyhqaykkgvpqfd
    lkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeen
    vredsyhyeg