PDB entry 4uqt

View 4uqt on RCSB PDB site
Description: RRM-peptide structure in RES complex
Class: translation
Keywords: translation
Deposited on 2014-06-25, released 2014-09-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U2 snRNP component IST3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uqta_
  • Chain 'B':
    Compound: Pre-mRNA-splicing factor CWC26
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uqtA (A:)
    gamgneykdnayiyignlnreltegdiltvfseygvpvdvilsrdentgesqgfaylkye
    dqrstilavdnlngfkiggralkidhtfyrpkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uqtA (A:)
    neykdnayiyignlnreltegdiltvfseygvpvdvilsrdentgesqgfaylkyedqrs
    tilavdnlngfkiggralkidhtfyrpkr
    

  • Chain 'B':
    No sequence available.