PDB entry 4upg

View 4upg on RCSB PDB site
Description: X-ray structure of calcium-free human sorcin
Class: metal binding protein
Keywords: metal binding protein, ca-binding protein, penta-ef hand, apoptosis regulation
Deposited on 2014-06-16, released 2014-06-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sorcin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30626 (0-168)
  Domains in SCOPe 2.08: d4upga_
• Heterogens: SO4, PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4upgA (A:)
  qtqdplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdmsgt
  mgfnefkelwavlngwrqhfisfdtdrsgtvdpqelqkalttmgfrlspqavnsiakrys
  tngkitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv