PDB entry 4unt

View 4unt on RCSB PDB site
Description: Induced monomer of the Mcg variable domain
Class: immune system
Keywords: immune system, bence-jones, light chains, immunoglobulin, amyloid
Deposited on 2014-05-30, released 2014-08-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.24557
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ig lambda chain v-II region mgc
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01709 (Start-110)
      • engineered mutation (38)
      • engineered mutation (99)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d4unta_
  • Chain 'B':
    Compound: ig lambda chain v-II region mgc
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01709 (Start-110)
      • engineered mutation (38)
      • engineered mutation (99)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d4untb_
  • Chain 'C':
    Compound: ig lambda chain v-II region mgc
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01709 (Start-110)
      • engineered mutation (38)
      • engineered mutation (99)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d4untc_
  • Chain 'D':
    Compound: ig lambda chain v-II region mgc
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01709 (Start-110)
      • engineered mutation (38)
      • engineered mutation (99)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d4untd_
  • Chain 'E':
    Compound: ig lambda chain v-II region mgc
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01709 (Start-110)
      • engineered mutation (38)
      • engineered mutation (99)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d4unte_
  • Chain 'F':
    Compound: ig lambda chain v-II region mgc
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01709 (Start-110)
      • engineered mutation (38)
      • engineered mutation (99)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d4untf_
  • Chain 'G':
    Compound: ig lambda chain v-II region mgc
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01709 (Start-110)
      • engineered mutation (38)
      • engineered mutation (99)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d4untg_
  • Chain 'H':
    Compound: ig lambda chain v-II region mgc
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01709 (Start-110)
      • engineered mutation (38)
      • engineered mutation (99)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d4unth_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4untA (A:)
    gqsaltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsg
    vpdrfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4untA (A:)
    saltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsgvp
    drfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4untB (B:)
    gqsaltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsg
    vpdrfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4untB (B:)
    saltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsgvp
    drfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4untC (C:)
    gqsaltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsg
    vpdrfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4untC (C:)
    saltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsgvp
    drfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4untD (D:)
    gqsaltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsg
    vpdrfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4untD (D:)
    saltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsgvp
    drfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4untE (E:)
    gqsaltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsg
    vpdrfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4untE (E:)
    saltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsgvp
    drfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4untF (F:)
    gqsaltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsg
    vpdrfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4untF (F:)
    saltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsgvp
    drfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4untG (G:)
    gqsaltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsg
    vpdrfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4untG (G:)
    saltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsgvp
    drfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4untH (H:)
    gqsaltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsg
    vpdrfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4untH (H:)
    saltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsgvp
    drfsgsksgntasledeadyycssyegsdnavegtgtkvtvl