PDB entry 4umx

View 4umx on RCSB PDB site
Description: IDH1 R132H in complex with cpd 1
Class: oxidoreductase
Keywords: oxidoreductase, isocitrate dehydrogenase inhibitor
Deposited on 2014-05-22, released 2014-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75874 (Start-413)
      • engineered mutation (131)
    Domains in SCOPe 2.07: d4umxa_
  • Chain 'B':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75874 (Start-413)
      • engineered mutation (131)
    Domains in SCOPe 2.07: d4umxb_
  • Heterogens: VVS, NAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4umxA (A:)
    mskkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkda
    aeaikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprl
    vsgwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvam
    gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfe
    aqkiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdg
    ktveaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanale
    evsietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqaklslehhh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4umxA (A:)
    kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
    aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs
    gwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm
    ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq
    kiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgkt
    veaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleev
    sietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4umxB (B:)
    mskkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkda
    aeaikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprl
    vsgwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvam
    gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfe
    aqkiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdg
    ktveaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanale
    evsietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqaklslehhh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4umxB (B:)
    kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
    aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs
    gwvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm
    ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq
    kiwyehrliddmvaqamkseggfiwacknydgdvqsgslgmmtsvlvcpdgktveaeaah
    gtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleevsietiea
    gfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl