PDB entry 4umj

View 4umj on RCSB PDB site
Description: Native structure of Farnesyl Pyrophosphate Synthase from Pseudomonas aeruginosa PA01, with bound ibandronic acid molecules.
Class: transferase
Keywords: transferase, fpps, bonviva, bisphosphonate
Deposited on 2014-05-18, released 2015-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4umja_
  • Chain 'B':
    Compound: Geranyltranstransferase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HWY4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d4umjb1, d4umjb2
  • Heterogens: MG, BFQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4umjA (A:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvesdtatlgktqg
    kdqahnkptypallgleaakgyalelrdlalaaldgfppsadplrqlaryiverrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4umjA (A:)
    iaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealgga
    pqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqalaf
    evladtrrnpqehavclemltrlaraagsagmvggqaidlgsldqaalevmhrhktgali
    easvrlgalasgraepaslaaleryaeaiglafqvqddildvptypallgleaakgyale
    lrdlalaaldgfppsadplrqlaryiver
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4umjB (B:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvesdtatlgktqg
    kdqahnkptypallgleaakgyalelrdlalaaldgfppsadplrqlaryiverrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4umjB (B:)
    smiaayqarcqarvdaaldalfvapreelqrlyeamrysvmnggkrvrpllayaacealg
    gapqradaaacavelihayslvhddlpamddddlrrgqptthrafdeatailaadglqal
    afevladtrrnpqehavclemltrlaraagsagmvggqaidlgsvgvaldqaalevmhrh
    ktgalieasvrlgalasgraepaslaaleryaeaiglafqvqddildvptypallgleaa
    kgyalelrdlalaaldgfppsadplrqlaryiv