PDB entry 4ulj

View 4ulj on RCSB PDB site
Description: Crystal structure of Phyllanthoside bound to the yeast 80S ribosome
Class: ribosome
Keywords: translation, ribosome, 40s, 60s, 80s, eukaryote, RNA-protein complex, inhibitor, antibiotic
Deposited on 2014-07-24, released 2014-10-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.203
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: saccharomyces cerevisiae chromosome xii cosmid 9634
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  
• Chain 'B':
  Compound: 40S ribosomal protein S0-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32905 (0-End)
• Chain 'C':
  Compound: 40S ribosomal protein S1-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P33442
• Chain 'D':
  Compound: 40S ribosomal protein S2
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25443
• Chain 'E':
  Compound: 40S ribosomal protein S3
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05750
• Chain 'F':
  Compound: 40S ribosomal protein S4-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX35 (0-259)
• Chain 'G':
  Compound: 40S ribosomal protein S5
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26783 (Start-223)
• Chain 'H':
  Compound: 40S ribosomal protein S6-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX37 (0-End)
• Chain 'I':
  Compound: 40S ribosomal protein S7-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26786
• Chain 'J':
  Compound: 40S ribosomal protein S8-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX39 (Start-199)
• Chain 'K':
  Compound: 40S ribosomal protein S9-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O13516 (0-End)
• Chain 'L':
  Compound: 40S ribosomal protein S10-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q08745 (0-End)
    • conflict (88)
• Chain 'M':
  Compound: 40S ribosomal protein S11-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX47 (0-154)
    • conflict (145)
• Chain 'N':
  Compound: 40s ribosomal protein s12
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48589 (Start-141)
    • conflict (102)
    • conflict (108)
• Chain 'O':
  Compound: 40S ribosomal protein S13
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05756 (0-149)
• Chain 'P':
  Compound: 40S ribosomal protein S14-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06367 (Start-135)
• Chain 'Q':
  Compound: 40S ribosomal protein S15
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01855
• Chain 'R':
  Compound: 40S ribosomal protein S16-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX51 (Start-141)
• Chain 'S':
  Compound: 40S ribosomal protein S17-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02407
• Chain 'T':
  Compound: 40S ribosomal protein S18-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX55 (0-144)
• Chain 'U':
  Compound: 40S ribosomal protein S19-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07280 (0-142)
• Chain 'V':
  Compound: 40S ribosomal protein S20
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38701 (Start-119)
• Chain 'W':
  Compound: 40S ribosomal protein S21-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C0V8 (0-86)
• Chain 'X':
  Compound: 40S ribosomal protein S22-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C0W1 (0-128)
• Chain 'Y':
  Compound: 40S ribosomal protein S23-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX29 (0-143)
• Chain 'Z':
  Compound: 40S ribosomal protein S24-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX31 (0-133)
• Chain 'a':
  Compound: 40S ribosomal protein S25-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3E792
• Chain 'b':
  Compound: 40s ribosomal protein s26-b
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39939 (0-96)
• Chain 'c':
  Compound: 40S ribosomal protein S27-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35997 (0-80)
• Chain 'd':
  Compound: 40S ribosomal protein S28-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3E7X9 (Start-65)
• Chain 'e':
  Compound: 40S ribosomal protein S29-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41057 (Start-54)
• Chain 'f':
  Compound: 40S ribosomal protein S30-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX33 (0-59)
• Chain 'g':
  Compound: Ubiquitin-40S ribosomal protein S31
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05759 (Start-75)
• Chain 'h':
  Compound: Guanine nucleotide-binding protein subunit beta-like protein
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38011 (0-317)
  Domains in SCOPe 2.08: d4uljh_
• Chain 'i':
  Compound: Suppressor protein STM1
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39015
• Heterogens: MG, OHX, ZN

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.
  
  
• Chain 'T':
  No sequence available.
  
  
• Chain 'U':
  No sequence available.
  
  
• Chain 'V':
  No sequence available.
  
  
• Chain 'W':
  No sequence available.
  
  
• Chain 'X':
  No sequence available.
  
  
• Chain 'Y':
  No sequence available.
  
  
• Chain 'Z':
  No sequence available.
  
  
• Chain 'a':
  No sequence available.
  
  
• Chain 'b':
  No sequence available.
  
  
• Chain 'c':
  No sequence available.
  
  
• Chain 'd':
  No sequence available.
  
  
• Chain 'e':
  No sequence available.
  
  
• Chain 'f':
  No sequence available.
  
  
• Chain 'g':
  No sequence available.
  
  
• Chain 'h':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4uljh (h:)
  asnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrsf
  kghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkasm
  iisgsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvkaw
  nlnqfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdevf
  slafspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqtl
  fagytdnvirvwqvmtan
  

  
  
• Chain 'i':
  No sequence available.