PDB entry 4uil

View 4uil on RCSB PDB site
Description: crystal structure of quinine-dependent Fab 314.1 with quinine
Class: immune system
Keywords: immune system, fab, quinine-dependent, mouse mab
Deposited on 2015-03-30, released 2015-09-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab 314.1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UIL (0-221)
  • Chain 'L':
    Compound: fab 314.1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UIL (0-212)
    Domains in SCOPe 2.06: d4uill1, d4uill2
  • Heterogens: QI9, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uilL (L:)
    divmtqttsslsaslgdrvtiscrasqdisnylswyqqkpdgtvkvliyytsklhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgntlpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne