PDB entry 4uij

View 4uij on RCSB PDB site
Description: Crystal structure of the BTB domain of KCTD13
Class: signaling protein
Keywords: signaling protein
Deposited on 2015-03-30, released 2015-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: btb/poz domain-containing adapter for cul3-mediated rhoa degradation protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uija_
  • Chain 'B':
    Compound: btb/poz domain-containing adapter for cul3-mediated rhoa degradation protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uijb_
  • Chain 'C':
    Compound: btb/poz domain-containing adapter for cul3-mediated rhoa degradation protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uijc_
  • Chain 'D':
    Compound: btb/poz domain-containing adapter for cul3-mediated rhoa degradation protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uijd_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uijA (A:)
    mhhhhhhssgvdlgtenlyfqsmgpaayglkpltpnskyvklnvggslhyttlrtltgqd
    tmlkamfsgrvevltdaggwvlidrsgrhfgtilnylrdgsvplpestrelgellgeary
    ylvqgliedcqlalqqkretl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uijA (A:)
    skyvklnvggslhyttlrtltgqdtmlkamfsgrvevltdaggwvlidrsgrhfgtilny
    lrdgsvplpestrelgellgearyylvqgliedcqlalqqkret
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uijB (B:)
    mhhhhhhssgvdlgtenlyfqsmgpaayglkpltpnskyvklnvggslhyttlrtltgqd
    tmlkamfsgrvevltdaggwvlidrsgrhfgtilnylrdgsvplpestrelgellgeary
    ylvqgliedcqlalqqkretl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uijB (B:)
    kyvklnvggslhyttlrtltgqdtmlkamfsgrvevltdaggwvlidrsgrhfgtilnyl
    rdgsvplpestrelgellgearyylvqgliedcqlalqqkret
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4uijC (C:)
    mhhhhhhssgvdlgtenlyfqsmgpaayglkpltpnskyvklnvggslhyttlrtltgqd
    tmlkamfsgrvevltdaggwvlidrsgrhfgtilnylrdgsvplpestrelgellgeary
    ylvqgliedcqlalqqkretl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uijC (C:)
    kyvklnvggslhyttlrtltgqdtmlkamfsgrvevltdaggwvlidrsgrhfgtilnyl
    rdgsvplpestrelgellgearyylvqgliedcqlalqqkre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4uijD (D:)
    mhhhhhhssgvdlgtenlyfqsmgpaayglkpltpnskyvklnvggslhyttlrtltgqd
    tmlkamfsgrvevltdaggwvlidrsgrhfgtilnylrdgsvplpestrelgellgeary
    ylvqgliedcqlalqqkretl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uijD (D:)
    kyvklnvggslhyttlrtltgqdtmlkamfsgrvevltdaggwvlidrsgrhfgtilnyl
    rdgsvplpestrelgellgearyylvqgliedcqlalqqkr