PDB entry 4uhk

View 4uhk on RCSB PDB site
Description: Crystal structure of the receiver domain of CpxR from E. coli (phosphorylated)
Class: transcription
Keywords: transcription
Deposited on 2015-03-24, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulatory protein cpxr
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE88 (Start-122)
      • expression tag (123-130)
    Domains in SCOPe 2.07: d4uhka1, d4uhka2
  • Chain 'B':
    Compound: transcriptional regulatory protein cpxr
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE88 (Start-122)
      • expression tag (123-128)
    Domains in SCOPe 2.07: d4uhkb1, d4uhkb2
  • Chain 'C':
    Compound: transcriptional regulatory protein cpxr
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE88 (Start-122)
      • expression tag (123-128)
    Domains in SCOPe 2.07: d4uhkc1, d4uhkc2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uhkA (A:)
    mnkillvdddreltsllkellemegfnvivahdgeqaldllddsidlllldvmmpkkngi
    dtlkalrqthqtpvimltargseldrvlglelgaddylpkpfndrelvarirailrrshw
    seqklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhkA (A:)
    nkillvdddreltsllkellemegfnvivahdgeqaldllddsidlllldvmmpkkngid
    tlkalrqthqtpvimltargseldrvlglelgaddylpkpfndrelvarirailrrshws
    eqklaaaleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uhkB (B:)
    mnkillvdddreltsllkellemegfnvivahdgeqaldllddsidlllldvmmpkkngi
    dtlkalrqthqtpvimltargseldrvlglelgaddylpkpfndrelvarirailrrshw
    seqklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhkB (B:)
    nkillvdddreltsllkellemegfnvivahdgeqaldllddsidlllldvmmpkkngid
    tlkalrqthqtpvimltargseldrvlglelgaddylpkpfndrelvarirailrrshws
    eqklaaal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4uhkC (C:)
    mnkillvdddreltsllkellemegfnvivahdgeqaldllddsidlllldvmmpkkngi
    dtlkalrqthqtpvimltargseldrvlglelgaddylpkpfndrelvarirailrrshw
    seqklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhkC (C:)
    nkillvdddreltsllkellemegfnvivahdgeqaldllddsidlllldvmmpkkngid
    tlkalrqthqtpvimltargseldrvlglelgaddylpkpfndrelvarirailrrshws
    eqklaaal