PDB entry 4uhd

View 4uhd on RCSB PDB site
Description: Structural studies of a thermophilic esterase from Thermogutta terrifontis (acetate bound)
Class: hydrolase
Keywords: hydrolase, alpha beta hydrolase
Deposited on 2015-03-24, released 2015-06-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: esterase
    Species: PLANCTOMYCETES BACTERIUM R1 [TaxId:1331910]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UHD
    Domains in SCOPe 2.06: d4uhda_
  • Heterogens: CL, MG, ACT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uhdA (A:)
    maqrvkitttatpgeielafedtgtglpvllvhgfpldrtmwkaqreelcdefrvivpdl
    rgfgesqvipgvatmeamaddlaglcnhlgltgkivlgglsmggyvafafarkyrdrlag
    lilcdtrarpdspeakenrrrvaervrregpgfiaeemiprlccestfrnhpeviekirq
    milsappegvaaaalgmaerpdstdllpalscptlvlvgqfdaisppeemeamartipqs
    qfvvipdaghlppmeqpervtqairewlrkvhteaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhdA (A:)
    aqrvkitttatpgeielafedtgtglpvllvhgfpldrtmwkaqreelcdefrvivpdlr
    gfgesqvipgvatmeamaddlaglcnhlgltgkivlgglsmggyvafafarkyrdrlagl
    ilcdtrarpdspeakenrrrvaervrregpgfiaeemiprlccestfrnhpeviekirqm
    ilsappegvaaaalgmaerpdstdllpalscptlvlvgqfdaisppeemeamartipqsq
    fvvipdaghlppmeqpervtqairewlrkvhtea