PDB entry 4ufa

View 4ufa on RCSB PDB site
Description: Crystal structure of the Angiotensin-1 converting enzyme N-domain in complex with Ac-SD
Class: hydrolase
Keywords: hydrolase, angiotensin-converting enzyme, metalloprotease, n-acetyl-ser-asp-lys-pro
Deposited on 2015-03-16, released 2015-10-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiotensin-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821 (0-End)
      • engineered mutation (8)
      • engineered mutation (24)
      • engineered mutation (81)
      • engineered mutation (116)
      • engineered mutation (288)
      • engineered mutation (544)
      • engineered mutation (575)
    Domains in SCOPe 2.05: d4ufaa_
  • Chain 'B':
    Compound: angiotensin-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821 (0-End)
      • engineered mutation (8)
      • engineered mutation (24)
      • engineered mutation (81)
      • engineered mutation (116)
      • engineered mutation (288)
      • engineered mutation (544)
      • engineered mutation (575)
    Domains in SCOPe 2.05: d4ufab_
  • Heterogens: ZN, CL, NAG, PEG, P6G, SAC, ASP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ufaA (A:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclpqktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypegidlvtdeaeaskfveeydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ufaA (A:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvcltatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftalsn
    eaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryin
    lrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeeffts
    lelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhem
    ghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdin
    yllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrneth
    fdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkv
    lragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhppl
    pdnypeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ufaB (B:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclpqktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypegidlvtdeaeaskfveeydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ufaB (B:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvcltatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftalsn
    eaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryin
    lrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeeffts
    lelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhem
    ghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdin
    yllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrneth
    fdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkv
    lragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhppl
    pdnypeg