PDB entry 4udo

View 4udo on RCSB PDB site
Description: structure of Mn-bound periplasmic metal binding protein from candidatus liberibacter asiaticus
Class: metal binding protein
Keywords: metal binding protein, metal ion transporter, periplasmic
Deposited on 2014-12-10, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic solute binding protein
    Species: Candidatus Liberibacter asiaticus [TaxId:34021]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4udoa_
  • Heterogens: SO4, GOL, MN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4udoA (A:)
    ttqkkvvlssfsiigditqniakdlvtvttlveagndshsyqvtsadaikiqnadlilcn
    glhleetymkyftnlkkgtkiitvtdginpigvsedtsvdsepnphawmsltnamiyien
    irkaltaldpsnakkyelnareysekirnsilplktriekvdpekrwfvtsegclvylae
    dfgfkslylwpinsdserspsmmrhainqmrshkikfifsestnsdqpakqvayetnasy
    ggvlyvdslskpdgpaptyldllrfsltkivdtlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4udoA (A:)
    kkvvlssfsiigditqniakdlvtvttlveagndshsyqvtsadaikiqnadlilcnglh
    leetymkyftnlkkgtkiitvtdginpigvseddsepnphawmsltnamiyienirkalt
    aldpsnakkyelnareysekirnsilplktriekvdpekrwfvtsegclvylaedfgfks
    lylwpinsrspsmmrhainqmrshkikfifsestnsdqpakqvayetnasyggvlyvdsl
    skpdgpaptyldllrfsltkivdtlf