PDB entry 4udb

View 4udb on RCSB PDB site
Description: MR in complex with desisobutyrylciclesonide
Class: signaling protein
Keywords: signaling protein, nuclear hormone receptor, ligand complex, peptide complex
Deposited on 2014-12-09, released 2015-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mineralocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08235
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (197)
    Domains in SCOPe 2.07: d4udba_
  • Chain 'B':
    Compound: Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DMS, GOL, SO4, CV7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4udbA (A:)
    mhnhnhnhnhnhnggenlyfqgtpspvmvleniepeivyagydsskpdtaenllstlnrl
    agkqmiqvvkwakvlpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapd
    lvfneekmhqsamyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaaf
    eemrtnyikelrkmvtkspnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshal
    kvefpamlveiisdqlpkvesgnakplyfhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4udbA (A:)
    spvmvleniepeivyagydpdtaenllstlnrlagkqmiqvvkwakvlpgfknlpledqi
    tliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhqsamyelcqgmhqislqf
    vrlqltfeeytimkvllllstipkdglksqaafeemrtnyikelrkmvtkspnnsgqswq
    rfyqltklldsmhdlvsdllefcfytfreshalkvefpamlveiisdqlpkvesgnakpl
    yfhr
    

  • Chain 'B':
    No sequence available.