PDB entry 4ubw

View 4ubw on RCSB PDB site
Description: Apo structure of the 3-ketoacyl-CoA thiolase FadA5 from M. tuberculosis
Class: transferase
Keywords: degradative thiolase, apo, Mycobacterium tuberculosis, cholesterol metabolism, transferase
Deposited on 2014-08-13, released 2014-12-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.175
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-CoA acetyltransferase FadA5
    Species: Mycobacterium tuberculosis ATCC 25618 / H37Rv [TaxId:83332]
    Gene: fadA5, Rv3546, P425_03688, RVBD_3546
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ubwa1, d4ubwa2
  • Chain 'B':
    Compound: Acetyl-CoA acetyltransferase FadA5
    Species: Mycobacterium tuberculosis ATCC 25618 / H37Rv [TaxId:83332]
    Gene: fadA5, Rv3546, P425_03688, RVBD_3546
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ubwb1, d4ubwb2
  • Heterogens: GOL, DMS, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ubwA (A:)
    hhhhhhgsmgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdv
    eqviggcvtqfgeqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagai
    dvgiacgieamsrvglganagpdrsliraqswdidlpnqfeaaeriakrrgitredvdvf
    glesqrraqrawaegrfdreispiqapvldeqnqptgerrlvfrdqglrettmaglgelk
    pvleggihtagtssqisdgaaavlwmdeavarahgltprarivaqalvgaepyyhldgpv
    qstakvlekagmkigdidiveineafasvvlswarvhepdmdrvnvnggaialghpvgct
    gsrlittalhelertdqslalitmcaggalstgtiieri
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ubwA (A:)
    mgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdveqviggcv
    tqfgeqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagaidvgiacgi
    eamsrvglganagpdrswdidlpnqfeaaeriakrrgitredvdvfglesqrraqrawae
    grfdreispiqapvldeqnqptgerrlvfrdqglrettmaglgelkpvleggihtagtss
    qisdgaaavlwmdeavarahgltprarivaqalvgaepyyhldgpvqstakvlekagmki
    gdidiveineafasvvlswarvhepdmdrvnvnggaialghpvgctgsrlittalheler
    tdqslalitmcaggalstgtiieri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ubwB (B:)
    hhhhhhgsmgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdv
    eqviggcvtqfgeqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagai
    dvgiacgieamsrvglganagpdrsliraqswdidlpnqfeaaeriakrrgitredvdvf
    glesqrraqrawaegrfdreispiqapvldeqnqptgerrlvfrdqglrettmaglgelk
    pvleggihtagtssqisdgaaavlwmdeavarahgltprarivaqalvgaepyyhldgpv
    qstakvlekagmkigdidiveineafasvvlswarvhepdmdrvnvnggaialghpvgct
    gsrlittalhelertdqslalitmcaggalstgtiieri
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ubwB (B:)
    mgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdveqviggcv
    tqfgeqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagaidvgiacgi
    eamsrvglganagpdrsliraqswdidlpnqfeaaeriakrrgitredvdvfglesqrra
    qrawaegrfdreispiqapvldeqnqptgerrlvfrdqglrettmaglgelkpvleggih
    tagtssqisdgaaavlwmdeavarahgltprarivaqalvgaepyyhldgpvqstakvle
    kagmkigdidiveineafasvvlswarvhepdmdrvnvnggaialghpvgctgsrlitta
    lhelertdqslalitmcaggalstgtiieri