PDB entry 4uav

View 4uav on RCSB PDB site
Description: Crystal structure of CbbY (AT3G48420) from Arabidobsis thaliana
Class: hydrolase
Keywords: haloacid dehalogenase (HAD) hydrolase superfamily, phosphatase, hydrolase
Deposited on 2014-08-11, released 2014-12-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haloacid dehalogenase-like hydrolase domain-containing protein At3g48420
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g48420, T29H11.60
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4uava_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4uavA (A:)
tlpsallfdcdgvlvdtekdghrisfndtfkerdlnvtwdvdlygellkigggkermtay
fnkvgwpekapkdeaerkefiaglhkqktelfmvliekkllplrpgvaklvdqaltngvk
vavcstsnekavsaivscllgperaekikifagdvvpkkkpdpaiynlaaetlgvdpskc
vvvedsaiglaaakaagmtcivtksgytadedfenadavfdcigdppeerfdlafcgsll
rkqfvs