PDB entry 4uao

View 4uao on RCSB PDB site
Description: Crystal structure of Apical Membrane Antigen 1 from Plasmodium Knowlesi in complex with an invasion inhibitory antibody
Class: cell invasion
Keywords: Malaria, cell invasion, invasion inhibitory antibody
Deposited on 2014-08-11, released 2015-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apical merozoite antigen 1
    Species: Plasmodium knowlesi [TaxId:5850]
    Gene: PKH_093110
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3L5E1
      • engineered mutation (66)
      • engineered mutation (137)
      • engineered mutation (148)
      • engineered mutation (199)
  • Chain 'B':
    Compound: immunoglobulin R31C2 light chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UAO (0-213)
    Domains in SCOPe 2.07: d4uaob1, d4uaob2
  • Chain 'C':
    Compound: immunoglobulin R31C2 VH and CH1 regions
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UAO (0-222)

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uaoB (B:)
    diqmtqspssmsaslgdrvtitcqasqdignnliwfqqkpgksprrmiyyatklangvps
    rfsgsrsgsdysltiislesedmadyhclqykqfpltfgsgtrleikradaaptvsifpp
    steqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqdskdstysmsstls
    ltkadyeshnlytcevvhktssspvvksfnrnec
    

  • Chain 'C':
    No sequence available.