PDB entry 4uae

View 4uae on RCSB PDB site
Description: Importin alpha 3 delta IBB in complex with Influenza PB2 Nuclear Localization Domain
Class: protein transport
Keywords: importin karyopherin complex NLS, PROTEIN TRANSPORT
Deposited on 2014-08-08, released 2015-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit alpha-3
    Species: Homo sapiens [TaxId:9606]
    Gene: KPNA4, QIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uaea_
  • Chain 'F':
    Compound: Polymerase basic protein 2
    Species: Influenza A virus [TaxId:392809]
    Gene: pb2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uaef_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uaeA (A:)
    mvqntsleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhclerd
    dnpslqfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalgniig
    dgpqcrdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqeilpa
    lcvlihhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqtaalr
    avgnivtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvqavid
    anlvpmiihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltvkdaq
    vvqvvldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiidqffs
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uaeA (A:)
    tsleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhclerddnps
    lqfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalgniigdgpq
    crdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqeilpalcvl
    ihhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqtaalravgn
    ivtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvqavidanlv
    pmiihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltvkdaqvvqv
    vldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiidqffss
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4uaeF (F:)
    gplgsdpdestsgvesavlrgflilgkedrrygpalsinelsnlakgekanvligqgdvv
    lvmkrkrdssiltdsqtatkrirmain
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uaeF (F:)
    vesavlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdssilt
    dsqtatkrirmain