PDB entry 4ua9

View 4ua9 on RCSB PDB site
Description: CTX-M-14 Class A Beta-Lactamase in Complex with a Boronic Acid Acylation Transition State Analog at Sub-Angstrom Resolution
Class: hydrolase
Keywords: CTX-M-14, Class A Beta-Lactamase, Boronic Acid, Acylation Transition State, HYDROLASE
Deposited on 2014-08-08, released 2015-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 0.84 Å
R-factor: N/A
AEROSPACI score: 1.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase CTX-M-14
    Species: Escherichia coli [TaxId:562]
    Gene: CTX-M-14
    Database cross-references and differences (RAF-indexed):
    • Uniprot H6UQI0 (1-262)
      • insertion (0)
    Domains in SCOPe 2.06: d4ua9a_
  • Chain 'B':
    Compound: beta-lactamase CTX-M-14
    Species: Escherichia coli [TaxId:562]
    Gene: CTX-M-14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ua9b_
  • Heterogens: CB4, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ua9A (A:)
    etsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ua9B (B:)
    etsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
    tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
    ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
    qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq
    pqqnaesrrdvlasaariiaegl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ua9B (B:)
    avqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetqk
    qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
    tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
    twlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpqq
    naesrrdvlasaariiaegl