PDB entry 4u83

View 4u83 on RCSB PDB site
Description: Structure of Brucella Abortus Butyryl-CoA dehydrogenase
Class: oxidoreductase
Keywords: Butyryl-CoA dehydrogenase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, OXIDOREDUCTASE
Deposited on 2014-08-01, released 2014-12-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: Brucella abortus [TaxId:1104320]
    Gene: BAA13334_II01457
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8T5D9 (7-381)
      • expression tag (3-6)
      • conflict (59)
      • conflict (69)
    Domains in SCOPe 2.07: d4u83a1, d4u83a2, d4u83a3
  • Chain 'B':
    Compound: acyl-CoA dehydrogenase
    Species: Brucella abortus [TaxId:1104320]
    Gene: BAA13334_II01457
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8T5D9 (7-381)
      • expression tag (4-6)
      • conflict (59)
      • conflict (69)
    Domains in SCOPe 2.07: d4u83b1, d4u83b2, d4u83b3
  • Chain 'C':
    Compound: acyl-CoA dehydrogenase
    Species: Brucella abortus [TaxId:1104320]
    Gene: BAA13334_II01457
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8T5D9 (7-381)
      • expression tag (5-6)
      • conflict (59)
      • conflict (69)
    Domains in SCOPe 2.07: d4u83c1, d4u83c2, d4u83c3
  • Chain 'D':
    Compound: acyl-CoA dehydrogenase
    Species: Brucella abortus [TaxId:1104320]
    Gene: BAA13334_II01457
    Database cross-references and differences (RAF-indexed):
    • Uniprot G8T5D9 (7-381)
      • expression tag (5-6)
      • conflict (59)
      • conflict (69)
    Domains in SCOPe 2.07: d4u83d1, d4u83d2, d4u83d3
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u83A (A:)
    ahhhhhhmlltdtqeqireaardfaqerlapgaaardrehafpraeltemgalgflgmla
    peewggsdldmvayalaleeiaagdgacstivsvhssvgcmpilrfgtedqkrrflpkma
    cgewiggfaltepqagsdasalktrarldgdhyvidgskqfitsgkngnvvivfavtdpa
    agkkgisafivptdtpgyevmsvehklgqhssdtcalgftnmrvpvenrlgaegegykia
    lanleggrigiaaqavgmaraafeaardyareritfgkpiiehqavafrladmatrieta
    rqmvlhaaalreagkpclteasmaklvasemaeqvcsaaiqihggygyladypveriyrd
    vrvcqiyegtsdvqrlviargl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u83A (A:)
    hhhhmlltdtqeqireaardfaqerlapgaaardrehafpraeltemgalgflgmlapee
    wggsdldmvayalaleeiaagdgacstivsvhssvgcmpilrfgtedqkrrflpkmacge
    wiggfalteplktrarldgdhyvidgskqfitsgkngnvvivfavtdpaagkkgisafiv
    ptdtpgyevmsvehklgqhssdtcalgftnmrvpvenrlgaegegykialanleggrigi
    aaqavgmaraafeaardyareritfgkpiiehqavafrladmatrietarqmvlhaaalr
    eagkpclteasmaklvasemaeqvcsaaiqihggygyladypveriyrdvrvcqiyegts
    dvqrlviargl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u83B (B:)
    ahhhhhhmlltdtqeqireaardfaqerlapgaaardrehafpraeltemgalgflgmla
    peewggsdldmvayalaleeiaagdgacstivsvhssvgcmpilrfgtedqkrrflpkma
    cgewiggfaltepqagsdasalktrarldgdhyvidgskqfitsgkngnvvivfavtdpa
    agkkgisafivptdtpgyevmsvehklgqhssdtcalgftnmrvpvenrlgaegegykia
    lanleggrigiaaqavgmaraafeaardyareritfgkpiiehqavafrladmatrieta
    rqmvlhaaalreagkpclteasmaklvasemaeqvcsaaiqihggygyladypveriyrd
    vrvcqiyegtsdvqrlviargl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u83B (B:)
    hhhmlltdtqeqireaardfaqerlapgaaardrehafpraeltemgalgflgmlapeew
    ggsdldmvayalaleeiaagdgacstivsvhssvgcmpilrfgtedqkrrflpkmacgew
    iggfalteplktrarldgdhyvidgskqfitsgkngnvvivfavtdpaagkkgisafivp
    tdtpgyevmsvehklgqhssdtcalgftnmrvpvenrlgaegegykialanleggrigia
    aqavgmaraafeaardyareritfgkpiiehqavafrladmatrietarqmvlhaaalre
    agkpclteasmaklvasemaeqvcsaaiqihggygyladypveriyrdvrvcqiyegtsd
    vqrlviargl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4u83C (C:)
    ahhhhhhmlltdtqeqireaardfaqerlapgaaardrehafpraeltemgalgflgmla
    peewggsdldmvayalaleeiaagdgacstivsvhssvgcmpilrfgtedqkrrflpkma
    cgewiggfaltepqagsdasalktrarldgdhyvidgskqfitsgkngnvvivfavtdpa
    agkkgisafivptdtpgyevmsvehklgqhssdtcalgftnmrvpvenrlgaegegykia
    lanleggrigiaaqavgmaraafeaardyareritfgkpiiehqavafrladmatrieta
    rqmvlhaaalreagkpclteasmaklvasemaeqvcsaaiqihggygyladypveriyrd
    vrvcqiyegtsdvqrlviargl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u83C (C:)
    hhmlltdtqeqireaardfaqerlapgaaardrehafpraeltemgalgflgmlapeewg
    gsdldmvayalaleeiaagdgacstivsvhssvgcmpilrfgtedqkrrflpkmacgewi
    ggfalteplktrarldgdhyvidgskqfitsgkngnvvivfavtdpaagkkgisafivpt
    dtpgyevmsvehklgqhssdtcalgftnmrvpvenrlgaegegykialanleggrigiaa
    qavgmaraafeaardyareritfgkpiiehqavafrladmatrietarqmvlhaaalrea
    gkpclteasmaklvasemaeqvcsaaiqihggygyladypveriyrdvrvcqiyegtsdv
    qrlviargl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4u83D (D:)
    ahhhhhhmlltdtqeqireaardfaqerlapgaaardrehafpraeltemgalgflgmla
    peewggsdldmvayalaleeiaagdgacstivsvhssvgcmpilrfgtedqkrrflpkma
    cgewiggfaltepqagsdasalktrarldgdhyvidgskqfitsgkngnvvivfavtdpa
    agkkgisafivptdtpgyevmsvehklgqhssdtcalgftnmrvpvenrlgaegegykia
    lanleggrigiaaqavgmaraafeaardyareritfgkpiiehqavafrladmatrieta
    rqmvlhaaalreagkpclteasmaklvasemaeqvcsaaiqihggygyladypveriyrd
    vrvcqiyegtsdvqrlviargl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u83D (D:)
    hhmlltdtqeqireaardfaqerlapgaaardrehafpraeltemgalgflgmlapeewg
    gsdldmvayalaleeiaagdgacstivsvhssvgcmpilrfgtedqkrrflpkmacgewi
    ggfalteplktrarldgdhyvidgskqfitsgkngnvvivfavtdpaagkkgisafivpt
    dtpgyevmsvehklgqhssdtcalgftnmrvpvenrlgaegegykialanleggrigiaa
    qavgmaraafeaardyareritfhqavafrladmatrietarqmvlhaaalreagkpclt
    easmaklvasemaeqvcsaaiqihggygyladypveriyrdvrvcqiyegtsdvqrlvia
    rgl