PDB entry 4u6h

View 4u6h on RCSB PDB site
Description: Vaccinia L1/M12B9-Fab complex
Class: immune system
Keywords: IgG2a, Fab, heavy chain light chain, IMMUNE SYSTEM
Deposited on 2014-07-29, released 2014-08-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heavy chain of murine anti-vaccinia L1 IgG2a antibody M12B9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4U6H (0-218)
  • Chain 'B':
    Compound: Light chain of murine anti-vaccinia L1 IgG2a antibody M12B9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4U6H (0-End)
    Domains in SCOPe 2.07: d4u6hb1, d4u6hb2
  • Chain 'C':
    Compound: Heavy chain of murine anti-vaccinia L1 IgG2a antibody M12B9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4U6H (Start-218)
  • Chain 'D':
    Compound: Light chain of murine anti-vaccinia L1 IgG2a antibody M12B9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4U6H (0-End)
    Domains in SCOPe 2.07: d4u6hd1, d4u6hd2
  • Chain 'E':
    Compound: Protein L1
    Species: Vaccinia virus [TaxId:10254]
    Gene: VACWR088, L1R
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Protein L1
    Species: Vaccinia virus [TaxId:10254]
    Gene: VACWR088, L1R
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u6hB (B:)
    dvvmtqiplslpvslgdqasiscrssqslvhsngntylhwslqkpgqspnlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthdpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u6hB (B:)
    dvvmtqiplslpvslgdqasiscrssqslvhsngntylhwslqkpgqspnlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthdpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4u6hD (D:)
    dvvmtqiplslpvslgdqasiscrssqslvhsngntylhwslqkpgqspnlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthdpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u6hD (D:)
    dvvmtqiplslpvslgdqasiscrssqslvhsngntylhwslqkpgqspnlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthdpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'E':
    No sequence available.

  • Chain 'J':
    No sequence available.